Répondre à la discussion
Affichage des résultats 1 à 7 sur 7


  1. #1



    svp, aidez moi a trouver de bons liens pour les cours de la bioinformatique, je parle des notions de bases et comment on peut la concrétiser, je trouve pas mal de difficulté a comprendre cette matière puisque qu'on a pas un vrais support sur quoi on peut se baser merci d'avance ..:


  2. Publicité
  3. #2

    Re : bioinformatique

    Ah, la discipline qui entre autres t'apprend à te servir de différents sites du net pour trouver les informations que tu cherches, c'est ça ?
    J'ai fait un truc tout simple, j'ai tapé bioinformatique, je suis tombé sur 2 liens vers des cours en ligne. Et que 2 car j'ai regardé cette page à peu près 5 secondes

  4. #3

  5. #4

    Re : bioinformatique

    merci bp, en ce qui concerne les notions de base ces sites que tu m a donne sont bons... merciiiii Edelweiss68, just un petit probleme que je coinside lors de ma recherche sur la structure 3D d'une proteine (http://swissmodel.expasy.org/) je rentre ma sequence proteique mais ca marche pas et puisque je choisis automated mode, ca continue a chercher mais sans me donner aucun resultats, est ce normale!! j'ai reussit une fois a avoir la forme 3D, mais apres, ca marche pas meme avec la meme sequence!

  6. #5

    Re : bioinformatique

    Citation Envoyé par rimbio Voir le message
    merci bp, en ce qui concerne les notions de base ces sites que tu m a donne sont bons... merciiiii Edelweiss68, just un petit probleme que je coinside lors de ma recherche sur la structure 3D d'une proteine (http://swissmodel.expasy.org/) je rentre ma sequence proteique mais ca marche pas et puisque je choisis automated mode, ca continue a chercher mais sans me donner aucun resultats, est ce normale!! j'ai reussit une fois a avoir la forme 3D, mais apres, ca marche pas meme avec la meme sequence!
    Alors, avant tout, une chose essentielle : en bio ou ailleurs, on ne dit pas "ça marche pas". Ca veut dire quoi ? Tu expliques exactement quelle erreur tu obtiens. Sinon, désolée, pas de boule de cristal dans les environs.

    Ensuite, on ne sait pas quelle séquence tu mets, on ne sait rien : comment veux-tu que quelqu'un te dise quoi que ce soit ?

    Merci donc à veiller à la clarté de ta demande.
    An expert is one who knows more and more about less and less.

  7. #6

    Re : bioinformatique

    Citation Envoyé par MaliciaR Voir le message
    Alors, avant tout, une chose essentielle : en bio ou ailleurs, on ne dit pas "ça marche pas". Ca veut dire quoi ? Tu expliques exactement quelle erreur tu obtiens. Sinon, désolée, pas de boule de cristal dans les environs.

    Ensuite, on ne sait pas quelle séquence tu mets, on ne sait rien : comment veux-tu que quelqu'un te dise quoi que ce soit ?

    Merci donc à veiller à la clarté de ta demande.

    bah j ai dit que lorsque je rentre ma séquence protéique en mettant automated mode ça continu a chercher sans me donner aucun résultats!! et pour la séquence je demande pas de me chercher la forme de ma séquence! je veux juste savoir est ce c'est normal que ça prend beaucoup de temps avant me donner la forme, il faux attendre et se patienter! ou s'il continu a chercher (a s'actualiser ) ça veux dire qu'il n'a rien trouvé, ca arrive parfois jusqu'à, après je ferme le site 1h
    et si vous voulez bien que vous essayer voila la séquence que je rentre: ASCTTNCLAPVAKVLNEKFGIAEGLMTTVH ATTATQLVVDGPSKGGKDWRAGRA

    bonne chance

  8. #7

    Re : bioinformatique

    J'obtiens ça :
    Your Request has been Submitted:
    The Request has been submitted to the queueing system and will run soon.
    Status of your Request is: submitted
    The results will be displayed in this page .
    Donc, faut attendre. Ou donner ton mail, le résultat t'y sera envoyé. Est-ce que tu as eu ce message ? Le "The results will be displayed in this page ." est un lien où faut cliquer.

    Je ne comprends donc pas où est le problème. Indexer une banque de données de cette taille n'est pas fait en 1 sec.

    EDIT: et j'obtiens bien un résultat :
    Workunit: P009069

    Model info:
    modelled residue range: 1 to 167
    based on template 1gadP (1.80 Å)
    Sequence Identity [%]: 73.054
    Evalue: 5.20e-62
    Voici le lien, peut-être que tu pourras y accéder : http://swissmodel.expasy.org/workspa...&prjid=P009069
    An expert is one who knows more and more about less and less.

Discussions similaires

  1. bioinformatique
    Par bapio dans le forum Lectures scientifiques
    Réponses: 0
    Dernier message: 06/02/2009, 19h55
  2. [Licence (L1-L2-L3)] Bioinformatique
    Par mrima dans le forum Exercices en biologie
    Réponses: 1
    Dernier message: 02/01/2009, 12h18
  3. [Biologie Moléculaire] bioinformatique
    Par mrima dans le forum Biologie
    Réponses: 0
    Dernier message: 29/12/2008, 12h45
  4. Bioinformatique
    Par teagol dans le forum Orientation après le BAC
    Réponses: 26
    Dernier message: 04/04/2008, 15h54
  5. [Divers] la bioinformatique
    Par manou24 dans le forum Biologie
    Réponses: 4
    Dernier message: 26/12/2007, 20h57